PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G092800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 181aa    MW: 19184.3 Da    PI: 8.1921
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G092800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.34.6e-5830126197
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+kyr
  Brast08G092800.1.p  30 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYR 120
                         69***************************************************************************************** PP

               NF-YB  92 elegek 97 
                         e+ g++
  Brast08G092800.1.p 121 EVRGDS 126
                         ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-5429134IPR009072Histone-fold
SuperFamilySSF471132.95E-4033134IPR009072Histone-fold
PfamPF008082.3E-2836100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-226482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-2283101No hitNo description
PRINTSPR006151.2E-22102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MADAPASPGG GGGGSHDSGG SPRGGGYGGV REQDRFLPIA NISRIMKKAI PANGKIAKDA  60
KETVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM ATLGFEDYIE PLKVYLQKYR  120
EVRGDSKLTS KSGDGSVKKD TLGPHTGTSS SSAQGMGQQV AYNQGMGYMQ PQYHNGDISN  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-5029121193NF-YB
4awl_B5e-5029121294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-5029121294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0983151e-173FP098315.1 Phyllostachys edulis cDNA clone: bphylf037i08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568278.11e-108PREDICTED: nuclear transcription factor Y subunit B
SwissprotP252091e-102NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLI1HIM31e-108I1HIM3_BRADI; Uncharacterized protein
STRINGBRADI2G22940.11e-108(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.37e-70nuclear factor Y, subunit B8